PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_20385-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 184aa    MW: 19917.2 Da    PI: 8.8327
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_20385-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.14.3e-134887344
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
                     +++++E++ll++++++lG++ W+ Ia +++ gRt++++  +w
  TRIUR3_20385-P1 48 SFSEDEEDLLIKLHALLGNR-WSIIAGRLP-GRTGEEVEAHW 87
                     69******************.*********.**********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007172.0E-84593IPR001005SANT/Myb domain
PROSITE profilePS5129412.1374595IPR017930Myb domain
SuperFamilySSF466897.8E-104788IPR009057Homeodomain-like
PfamPF002495.2E-124887IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.0E-154887IPR009057Homeodomain-like
CDDcd001676.94E-114887No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009718Biological Processanthocyanin-containing compound biosynthetic process
GO:0010023Biological Processproanthocyanidin biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MTARHGRQWS RRRPKLLAGR LTTASSDAPS SLQPTTATRR LLAGTTTSFS EDEEDLLIKL  60
HALLGNRWSI IAGRLPGRTG EEVEAHWGSP AMRRRTGGAD PESHRVLLQA LLASSHDHPT  120
QPGEHLRRAV PNQVRDERPG RPTDDSAVSD AGSSKACALS DADSRFLAEL NLELTLSTPC  180
SAST
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM7ZPP51e-129M7ZPP5_TRIUA; Transcription repressor MYB4
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2780155
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71030.14e-20MYB-like 2